SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z032 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z032
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.000000484
Family Cell division protein ZapA-like 0.0067
Further Details:      
 
Weak hits

Sequence:  C4Z032
Domain Number - Region: 79-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4Z032
Sequence length 135
Comment (tr|C4Z032|C4Z032_EUBE2) Cell division protein ZapA {ECO:0000256|SAAS:SAAS00072473} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_00944 OC=Eubacterium.
Sequence
MSSKNTAEVILGGKVIKLGGYESEEYLQRVASYINNKITEFNKEESYRRMSAELRTDMMY
LNIADDYFKAKKMADSLSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQ
KNIVKLETELNDSKK
Download sequence
Identical sequences A0A174Z651 C4Z032 R5ZKR4
APC21094 515620.EUBELI_00944 WP_012739181.1.40640 WP_012739181.1.74791 gi|238916875|ref|YP_002930392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]