SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4Z099 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z099
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.05e-29
Family HD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4Z099
Sequence length 198
Comment (tr|C4Z099|C4Z099_EUBE2) Nicotinate-nucleotide adenylyltransferase {ECO:0000313|EMBL:ACR72012.1} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_01011 OC=Eubacterium.
Sequence
MDNKYIEQLRTQVKDALRTDNMRYQHTLGVANTSACLAMCHGADMNKAYIAGLLHDCAKC
VPDDVKIAECKQYGLPISDIELESPYLLHSKLGAYYAAHKYNVEDKEICSAIQWHTTGKP
AMTLLEKIVFIADYIEPYRNKADNLDDIRHMAFTDIDMAAYVILDDTLSYIRKTGRNIDT
QTVDTYDYYKGIIKEREN
Download sequence
Identical sequences C4Z099
WP_012739247.1.74791 gi|238916942|ref|YP_002930459.1| 515620.EUBELI_01011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]