SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z0K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z0K6
Domain Number 1 Region: 316-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-29
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 203-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4Z0K6
Sequence length 515
Comment (tr|C4Z0K6|C4Z0K6_EUBE2) Ribonuclease Y {ECO:0000256|HAMAP-Rule:MF_00335, ECO:0000256|SAAS:SAAS00548727} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_01119 OC=Eubacterium.
Sequence
MIPIVIAIIATLVIVAPITWFISSNAINKRNDATIGNANEKAREIIDEALKTAETKKKEA
LLEVKEESLKTKNELEKETKERRAEISKYEKRVLSKEETLDRKIEAVEKRDSNITRKEEE
LGKQKQKVEELEKKRQQELERISGLTSEQAKEYLLKTVEDEVKHDTAVMIKTLESRAKEE
ADKKAKEIVVNAIQRCAADHVAETTISVVQLPNDEMKGRIIGREGRNIRTLETLTGIELI
IDDTPEAVVLSGFDPVRREVARIALEKLILDGRIHPARIEEMVEKAQKEVETLIKEEGEA
ATLEVGVHGIHPELVRLLGKLRFRTSYGQNVLKHSIEVAQLTGLLAGELGLDVKMAKRAG
LLHDIGKAVDHEMEGSHIQLGVDLCRRYKESALVINAVEAHHGDVEPESLIACLVQAADT
ISAARPGARRETLETYTNRLKQLEDITNSFKGVEKSFAIQAGREVRVMVVPEVVSDSDMV
IMARDISKQIEDQMEYPGQIKVSIVRESRAVDYAK
Download sequence
Identical sequences C4Z0K6
515620.EUBELI_01119 gi|238917049|ref|YP_002930566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]