SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z4Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z4Y4
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.85e-79
Family HD domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4Z4Y4
Sequence length 335
Comment (tr|C4Z4Y4|C4Z4Y4_EUBE2) Deoxyguanosinetriphosphate triphosphohydrolase-like protein {ECO:0000256|HAMAP-Rule:MF_01212} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_00675 OC=Eubacterium.
Sequence
MNIREEQEKREHLIFSPYASFSDESRGRDRDEEPCPMRTIYQRDRDRIIHCKTFRRLKHK
TQVFLAPEGDHYRTRLTHTLEVAQIARSIARALNLNEDLTEAIALGHDLGHTPFGHAGER
TLNSLCPMGFAHYKQSIRVVEFLEKDGQGLNLTWEVRDGILNHRTSGNPSTLEGKAVRLS
DKIAYINHDIDDGIRAGILKESDIPSEYTDVLGNSTKERLNTMISDIIMNSIGKNDLVMS
EPVHKAMTELRKFMFESLYLNPTAKSEEAKADKLITELYRYYVANTDKLPDTYKRFITEF
DERPEQVVCDYIAGMSDQYSISKFQEIFVPKAWKG
Download sequence
Identical sequences A0A1Q6PFN8 C4Z4Y4
515620.EUBELI_00675 WP_012738924.1.74791 gi|238916618|ref|YP_002930135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]