SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z502 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z502
Domain Number 1 Region: 72-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-52
Family RecA protein-like (ATPase-domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 259-273,307-458
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-42
Family ATP-dependent protease Lon (La), catalytic domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4Z502
Sequence length 459
Comment (tr|C4Z502|C4Z502_EUBE2) DNA repair protein RadA {ECO:0000256|HAMAP-Rule:MF_01498, ECO:0000256|RuleBase:RU003555} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_00693 OC=Eubacterium.
Sequence
MAKAKNTAFFCKECGYESAKWFGQCPACKEWNTFVEEPVSKPKSAKGIAGTSQRAAASSA
PVPVEINSVSFEENDRTSTGIAELDRVLGGGIVAGSLVLVGGDPGIGKSTLLLQMCYNLS
AEGKDVLYISGEESLKQIKLRADRIGKCSGTLKLLCETSLDSIEDILTRNKPEIVIIDSI
QTMYKEDVAAAPGSVSQVRETTSILMQLAKGLNITIFIVGHVTKEGTVAGPRMLEHMVDT
VLYFEGDRYASYRILRGVKNRFGSTNEIGVFEMQQSGLSEVENPSEYMLNGRPENASGSV
VVCLLEGTRPIMVEIQALVCDSNFGMARRTAAGTDYNRVNLLMAVLEKRAGIHMSGSDAY
VNVAGGIKVSEPALDLGIVMALVSSFKNKAIDEKTVIFGEVGLAGEVRAVSQAQQRVNEA
VKLGFKTCILPGVCLKNIKKNDKIEIIGVNNVQEAIKLI
Download sequence
Identical sequences C4Z502
WP_012738942.1.74791 gi|238916636|ref|YP_002930153.1| 515620.EUBELI_00693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]