SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z5D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z5D1
Domain Number 1 Region: 134-244
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.46e-36
Family KorB DNA-binding domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 54-144
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 6.02e-27
Family ParB-like nuclease domain 0.00034
Further Details:      
 
Weak hits

Sequence:  C4Z5D1
Domain Number - Region: 232-283
Classification Level Classification E-value
Superfamily Outer surface protein C (OspC) 0.0049
Family Outer surface protein C (OspC) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4Z5D1
Sequence length 311
Comment (tr|C4Z5D1|C4Z5D1_EUBE2) Chromosome partitioning protein, ParB family {ECO:0000313|EMBL:ACR73038.1} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_02058 OC=Eubacterium.
Sequence
MVTEKKTSKISKSRGLGKGIAALIPEDDGNEDKVVVKEVVKEVVKEVPVPTETKLKISQI
EPNKNQPRKAFDEDALIELSESIKQYGVLQPLLVQKMDKNYQIIAGERRFRAARLAGVKE
VPVIIKDYSSQEVMEIALIENIQREDLNPIEEALAYRQLIKDYRLKQDEVAEKVAKSRTA
ITNSLRLLKLDDRVQEMVIEGKLSSGHARAIIGIEDKEKQYMVALKIFDEKLSVRDVEKL
VKNIDKLDKTVEKKKPENDFVYRDFEEKLKKIMGTQVVIKNKNNNKGKIEIQYYSQAELE
RIYDLLKKVNE
Download sequence
Identical sequences C4Z5D1
515620.EUBELI_02058 WP_012740270.1.74791 gi|238917968|ref|YP_002931485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]