SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z5I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z5I3
Domain Number 1 Region: 203-392
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.8e-57
Family Methylesterase CheB, C-terminal domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily CheY-like 1.85e-25
Family CheY-related 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4Z5I3
Sequence length 396
Comment (tr|C4Z5I3|C4Z5I3_EUBE2) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_00834 OC=Eubacterium.
Sequence
MAKKILVIDDSALMRRVISDIINEGNDYEVAAIAKDGLEGFDMIVSNPNLYSAIILDINM
PKMNGLELLQKLQKNHIEQTVIVVSTVAKEGAKETIQALEYGAFDFVTKPENYFETKGND
FKRRIHDMLNIATSSRASVERTKPAVSRITQSGSKLSSSLTSRLSSDKKASNDAISALRK
RNEVYDTLPPKVNPAKFTNIKSGTRKIVALACSTGGPKSLQQVIPMLPKNLDAGVVLVQH
MPAGFTASLAARLNEISDINVKEGADGDVIQKGWVYIAPGGKHIKVVKKAAEYVIKLNDE
PPIDGLRPCANVMYKSLVQCNYDEITCVVLTGMGADGTEGIKALSAGKKKIHVIAQDEES
CVVYGMPKAIAQTGLVDEVVPLNKIAETITKNVGVS
Download sequence
Identical sequences C4Z5I3
gi|238916772|ref|YP_002930289.1| WP_012739078.1.74791 515620.EUBELI_00834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]