SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Z6J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z6J6
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily YefM-like 0.00000000719
Family YefM-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4Z6J6
Sequence length 112
Comment (tr|C4Z6J6|C4Z6J6_EUBE2) Antitoxin {ECO:0000256|RuleBase:RU362080} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_20443 OC=Eubacterium.
Sequence
MEVVNVAIATNILQCLIPISQFNKGQASKIFDRLHDEKELIVLKNNQPSAVILSPEEYTR
LTEIEEDYYLLIEATKRIEDNGNKETVSMDYVMRNLGIDEKELENAEDIDIE
Download sequence
Identical sequences C4Z6J6
gi|238922208|ref|YP_002935722.1| 515620.EUBELI_20443 WP_012740716.1.74791 WP_012740716.1.89035 gi|238922208|ref|YP_002935722.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]