SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5A1Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5A1Y5
Domain Number 1 Region: 13-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-30
Family Clp protease, ClpP subunit 0.031
Further Details:      
 
Domain Number 2 Region: 377-442
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000000107
Family NfeD domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  C5A1Y5
Domain Number - Region: 252-382
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0562
Family LacY-like proton/sugar symporter 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5A1Y5
Sequence length 454
Comment (tr|C5A1Y5|C5A1Y5_THEGJ) Membrane bound protease, putative, nfeD/ClpP-family (NfeD) {ECO:0000313|EMBL:ACS34404.1} KW=Complete proteome; Reference proteome OX=593117 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3). GN=TGAM_1902 OC=Thermococcus.
Sequence
MIMKTRTLSRSAFIILVLMLLPAVLASPNQKTVYVAKFEGVITSYSVDQFSRYIEIAEKN
NAEALIIEIDTPGGSGQAMQEIIQRIKESKVPVIIYVYPPGAIAASAGTYIALGSHLIAM
APSTSIGACEPIMGYASNGSIIKAPAKVRNFYVAYIKSLAEASGRNVTAAERFITEDLSL
TPEEALRAHVIEVIANDVPDLLKKANGMKTKIPVKGKGYVTLNFTNARIVSIEPSFKDEV
VRYISDPTIAYVLINIGILGLIFGFLTPGWHVPETVGAILLVLGIIGLGYFGYNAAGLVL
IILAVIFFIAEALTPTFGLFTVAGAITMILGGILLFGGGNEYLIQRSTFSTLRAVIIAIA
VMLALFFAFGVSAVIRDRKRKAQTGKEEMIGEVGRVVQELNPEGMVKIRGELWKAESKTG
ERIGVGEKVRVVEVRGLTLIVVPEGVSPDEKKEV
Download sequence
Identical sequences C5A1Y5
593117.TGAM_1902 WP_015859510.1.60195 gi|240103959|ref|YP_002960268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]