SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5C335 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5C335
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-17
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5C335
Sequence length 115
Comment (tr|C5C335|C5C335_BEUC1) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ACQ81879.1} KW=Complete proteome; Reference proteome OX=471853 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432). GN=Bcav_3637 OC=Beutenbergia.
Sequence
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG
Download sequence
Identical sequences C5C335
WP_015884116.1.13559 APC37125 471853.Bcav_3637 gi|229822115|ref|YP_002883641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]