SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5CXW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5CXW7
Domain Number 1 Region: 343-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-24
Family CorC/HlyC domain-like 0.0000899
Further Details:      
 
Domain Number 2 Region: 202-337
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-20
Family CBS-domain pair 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5CXW7
Sequence length 427
Comment (tr|C5CXW7|C5CXW7_VARPS) Uncharacterized protein {ECO:0000313|EMBL:ACS20823.1} KW=Complete proteome OX=543728 OS=Variovorax paradoxus (strain S110). GN=Vapar_4210 OC=Comamonadaceae; Variovorax.
Sequence
MTLTQSLLIIVLLIAMSAFFSLAEITLAASRRLRLRQMADEGDARAERVLRVQEQPGHYF
TVVQIGLNAVAILGGVVGEGSLSPYFARFLEGWMSVEASANVAFLCSFVIVIAVFLVFAD
LFPKRLGMSDPERIAVRMVGPMMVLITAFKPLVWFFTRSTDMLFKLLGMPLVRDDKITSA
DILAMTEAGARAGVLAVREQQVIANVFELDTRLVSSVMTVRDNIAWFLHDDPESVLRARI
VAEPFSAYPVCDGDIDHVLGYVDAKEMFQRVLSGQPLAFDQGLTLHKALVIPDRLTLTEV
LEQFQQAHEDFAIVVNEYSLVVGVITLNDVMSTVMGDLVSMPDEEQIVKRDENSWLIDGV
TPIQDVQRALHIDEMPHPDDYETLAGFLMVMLRRVPKRTDSVSWGGYTFEVMDVDSYRID
QVMVTKT
Download sequence
Identical sequences C5CXW7
WP_015866984.1.27117 WP_015866984.1.44240 WP_015866984.1.84832 gi|239817179|ref|YP_002946089.1| 543728.Vapar_4210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]