SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5DHL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5DHL1
Domain Number 1 Region: 7-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.53e-112
Family IF2B-like 0.000000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5DHL1
Sequence length 417
Comment (sp|C5DHL1|MTNA_LACTC) Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein {ECO:0000255|HAMAP-Rule:MF_03119} KW=Complete proteome; Reference proteome OX=559295 OS=(Yeast) (Kluyveromyces thermotolerans). GN=KLTH0E05236g; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MSLEAIQFDRSHRDDISVRVLDQLLLPYTTKYVPIYTIDDGYTVINTMQVRGAPAIAIVG
ALAVLMEIQLLQNDGFARTQTFYDISSFELTRSALSQRLDFLLSSRPTAVNLSNALREIR
VLLAQSAGLAAFGNGVYDFVCRLIDEDLTNNVKMGDNGAAFLLDALQQEGFDEDFAVLTI
CNTGSLATSGYGTALGVVRSLWNDSLAKSQAPGDGSAKKRKLNQGRAKMVQVYPLETRPY
NQGARLTAYELVHDQIPATLIPDSSIAYRIATSPVPIKAAFVGADRIVRNGDTANKIGTY
QLALVCKHFGIKFFVTAPKTTIDSKTETGAGIVVEERKPNEFKHVSGTLIDSQTGLPCVD
NQDKPVSASVGVAPSEIDVWNPAFDITPHELIDGIVTEDGVFTKSASGSFDLTNLFA
Download sequence
Identical sequences C5DHL1
559295.KLTH0E05236g gnl|GLV|KLTH0E05236g XP_002553709.1.30775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]