SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5P0Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5P0Q0
Domain Number 1 Region: 25-74
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000441
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 84-121
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000183
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5P0Q0
Sequence length 725
Comment (tr|C5P0Q0|C5P0Q0_COCP7) Zinc finger, C2H2 type domain containing protein {ECO:0000313|EMBL:EER29258.1} KW=Complete proteome OX=222929 OS=Coccidioides posadasii (strain C735) (Valley fever fungus). GN=CPC735_069400 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MAPARSEGSDLGSALTPAPPVPGQHQCPICFRSYKRREHLQRHSHTHTSDRPHRCPACGC
SFQRADVLKRHWRTCDGRGSSKAVVRRRACDRCVRQKKACNSVQPCHNCARRGIPCQYSS
GINAPKPSTDIHSQAIDIDKDMLATTDPLTSTIEAMLPPSFEVGQFDNVTMNAFESFFDP
DLFDYASPSWQDFMHFTSDGQPARELTVSDGESSQIFHFLDNFTSKTGFIMSFDCGTLRQ
RQEVMSNIQCGVLAFEPQQGQRMNFESTNNPEGVSSGWFNDPLALKTHQILLLIKEVVTV
KPRNSSVTLYWSPALEQMCLQFFSPINLRKYLELYWAIWSPNVNFVHRPTFDPVSSKSIL
VASMAIIGACVSPDPVDNENARMWLNCVEEMVFADDDVNSFPVFPFDPAANRRKIQALQA
CYMVCLYQNWEGTDVTKRRIRRHRYSTVVSIVRDIGVATARHSNYSRKARHEFQWNDFVA
KEELIRTFLWIFLLDTAFVIFNNFPPRMVIKEMKNHVAAPEACFQAVTADQCFEQIQMWM
PAKSPFWRVSFRSAFETLCRGDLTADMRHILAALGPLNLFAIASAIHYLIFQYQNAFGGG
ELLQRIRDALGNWKDIWHIQANASPGTSPHSIVDSTNAQPEYMWKRVGFFRYSPDYWLLA
SLKVDRLSVADPCQPKSNAWTGQNDVELIGEDDDGLADPILNKYDETSMSQVNELISEFK
KVQVH
Download sequence
Identical sequences A0A0J6FJG5 C5P0Q0
CPAT_06807 222929.C5P0Q0 XP_003071403.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]