SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5PA85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C5PA85
Domain Number - Region: 266-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00167
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5PA85
Sequence length 1016
Comment (tr|C5PA85|C5PA85_COCP7) 5'-3' exoribonuclease {ECO:0000256|PIRNR:PIRNR037239} KW=Complete proteome OX=222929 OS=Coccidioides posadasii (strain C735) (Valley fever fungus). GN=CPC735_008200 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MGVPALFRWLSTKYPKIISAVVEELPQEIDGEEFPVDTTKPNPNGEEMDNLYLDMNGIVH
PCTHPEGKPAPANEGEMMLEIFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRSRRFR
SAQEAKEADEKKAEFAKLLRQQNRGKGDMEIAEEVVQKTWDSNVITPGTPFMDILSAALR
YWVAYKLNTDPAWEKVKIIISDATVPGEGEHKIMEFIRSQRSCPEHDANTRHVIYGLDAD
LIMLGLATHEPHFRVLREDVFFQESKARTCHLCGQQGHVAEACTGKAKEKNGEFDEKQRG
TPLKPFIWLHVSVLREYLAAEMYVPNQPFPFDLERALDDWVFMCFFVGNDFLPHLPSLEI
RENGIDTLIAIWRDNIPLMGGYLTQDGNVDLKRAQLILQGLAKQEDAIFRRRRQTEERRN
TNAKRRKEQERQREEENARKRPRHSLEDETAGPSPRRGKDMDGIAPANMPLFIPSKGELP
RAERELTHAMVVNRGAIYKANMANKSAAAALKSQLISGASEMSVEVSTSTSANDVSPSAL
GKRKADALETDNTTEQEDSERPPQEQDELPADSVRLWEQGYADRYYEQKFHVDPKDIEFR
HKVARAYVEGLCWVLLYYFQGCPSWTWYYPYHYAPFAADFVDLEHMDIQFHKGAPFRPFE
QLMGVLPAASNHAIPEIFRDLMSNPESEIIDFYPEEFPIDLNGKKFAWQGVALLPFIDES
RLLEAMAKRYPRLSEEEKARNEMGRDILFISDRHPLYRELVANFYSKKQSVPKFKLNMRV
SEGLGGKVERDEAYIPHSSLVASIDGIELPALDEDRSISVLYDIPKSMYTHKSMLLPGVK
FNPPVLDKTDIEVTKAKAQRSGRSFGGAPLHSGNGRGRGRISYASDRPNPFAAHLDPSFK
PPPHMNAPPGRGGPHQFDRHRSQNPPSQQSRGRGYGGYGGYGGSYGQRDSYHPPAPRGRD
SYQDRQDRQYQHQDRPYPPSGAGGGSGSNYYRGRGGGQQRSSQSGYYGRNDGYGRY
Download sequence
Identical sequences C5PA85
XP_003068792.1.1890 222929.C5PA85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]