SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6A4H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6A4H5
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.05e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C6A4H5
Sequence length 170
Comment (tr|C6A4H5|C6A4H5_THESM) 2-ketoglutarate:ferredoxin oxidoreductase (KGOR), subunit gamma {ECO:0000313|EMBL:ACS90520.1} KW=Complete proteome; Reference proteome OX=604354 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597). GN=TSIB_1469 OC=Thermococcus.
Sequence
MQIRLAGFGGQGVILAGVILGDAAAIEGLNVVQTQDYGSQSRGGHSIADLIISKDPIYDL
IVTKADVLLALAQLGYESTKESLKEGGLLIVDTGLVQPDKEFTGAPFTRIAEEKVGLALT
VNMVALGYLVAKTNVVKKESVEKAIRRRVPKGTEEINLKAFRTGYEEGMK
Download sequence
Identical sequences C6A4H5
WP_015849737.1.69891 604354.TSIB_1469 gi|242399444|ref|YP_002994869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]