SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6B991 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6B991
Domain Number 1 Region: 119-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.93e-57
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 61-117
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000325
Family GalR/LacI-like bacterial regulator 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6B991
Sequence length 391
Comment (tr|C6B991|C6B991_RHILS) Transcriptional regulator, LacI family {ECO:0000313|EMBL:ACS60479.1} KW=Complete proteome OX=395491 OS=Rhizobium leguminosarum bv. trifolii (strain WSM1325). GN=Rleg_5677 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MRIDAFHASDFAPPLSMLVSGQAPGYTREMDAKTRHNPMNNCRSPLEMHETDRTAGRRRG
ATIIDVARVADVAVGTVSRYLNGETVRRSNREQIERAIQELGYRRNAAAASIRTDLTHMI
GFLVPTFDEFHARMLEHLATSVRSTGRALLTYCHGGDPRVVAEALDFFAAQRVDALIMDG
TAEVYDRVDDLIEHDVPIIFYNNDVRGLAADRVMVENHRASYRLISHLIDLGHTRIGMLT
GDPRNSSGIERLAGYEHALRERGIVVDASLAVRGNWRMDGGYEATKRLMSLERPPTAIFS
ANYGMAVGALSWLKENGLHVPDDISLASFDDVAVFRLYEAGITAVAQPVAGIAEKITDIL
VERLTESSSGATHSIVLECDIILRGSTRRIT
Download sequence
Identical sequences C6B991
395491.Rleg_5677 gi|241518402|ref|YP_002979030.1| gi|241518402|ref|YP_002979030.1|NC_012853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]