SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6BI12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6BI12
Domain Number - Region: 20-107
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000424
Family D-glucarate dehydratase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6BI12
Sequence length 278
Comment (tr|C6BI12|C6BI12_RALP1) Uncharacterized protein {ECO:0000313|EMBL:ACS64608.1} KW=Complete proteome OX=428406 OS=Ralstonia pickettii (strain 12D). GN=Rpic12D_3344 OC=Burkholderiaceae; Ralstonia.
Sequence
MVTQPIAIAVAPNGARKTHADHPALPITPDELAACARQCVDAGAAMLHLHVRRPDGTHSL
EPGDYRPAIAAVRHAVGDALVIQITTEAVGIYTPEQQMASVRALQPEAISAALRELAPDA
AHEAEAARFFGELAAARTAIQYILYSADDVARYRDLRTRGVLPDTSHWVLFVLGRYSAGQ
HSDPTDLLQFLQAWADGGDLTANVPWAMCAFGPREAECALTAALLGGHARLGFENNMALP
DGSTAPDNAALVTNLRRHLDALHRPLASAADLRSWFGR
Download sequence
Identical sequences C6BI12
428406.Rpic12D_3344 gi|241664920|ref|YP_002983280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]