SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6CTU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6CTU2
Domain Number 1 Region: 46-216
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.06e-21
Family Clp protease, ClpP subunit 0.09
Further Details:      
 
Domain Number 2 Region: 397-457
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000275
Family NfeD domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  C6CTU2
Domain Number - Region: 278-360
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0968
Family Calcium ATPase, transmembrane domain M 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6CTU2
Sequence length 458
Comment (tr|C6CTU2|C6CTU2_PAESJ) Uncharacterized protein {ECO:0000313|EMBL:ACT00882.1} KW=Complete proteome; Reference proteome OX=324057 OS=Paenibacillus sp. (strain JDR-2). GN=Pjdr2_2226 OC=Paenibacillus.
Sequence
MQTKRWRIAAVIWPLLMLISMLLVTAGGLVTGGKAAQGAEGSGLGPAVYVVPVKQTVESG
LKSFLERAYKEAAEAKAERVILVINTFGGEVTSAEEIGELIRKSSVPTTAYVEGKAVSAG
TYIALNAQNIVMEPGSTIGAAAVVNGSGDLIDNPKVVSFWVKTMREAAELNGRNPDIAAA
MVDTGATLPLPDLKQVKQSGQILTLTADEALKVGYAEYKAESVEDAIKWLGLENREQIDL
NPSIAEKIASWLVNPVVMTVLFILGIAGIAIELFVPGFGVPGIVGILSFGLYFFGHYIAG
FAGMESVVLFIVGVALLLVEVFVPSWGILGILGSASLIAGVLTAASNPMTAFVSLVIALV
AAAVILYFVVRKYKDRGIWNKFILREKLTTEQGYLSAETKEDLLGQEGIAITPLRPAGTI
QIRDNRIDVVTSGEFIASGKTVKVIKTEGTWVVVREVL
Download sequence
Identical sequences C6CTU2
324057.Pjdr2_2226 WP_015843826.1.29859 gi|251796237|ref|YP_003010968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]