SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6E4I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6E4I0
Domain Number - Region: 222-265
Classification Level Classification E-value
Superfamily MtlR-like 0.0366
Family MtlR-like 0.015
Further Details:      
 
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 0.0549
Family ChuX-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C6E4I0
Sequence length 346
Comment (tr|C6E4I0|C6E4I0_GEOSM) Uncharacterized protein {ECO:0000313|EMBL:ACT17478.1} KW=Complete proteome OX=443144 OS=Geobacter sp. (strain M21). GN=GM21_1419 OC=Geobacteraceae; Geobacter.
Sequence
MKHWTEPHGILLMQIPIEWQYRNAAIEGVKEESPFSFEPYDGAIGCFQLSCYPLAELAPN
LKDKVPKGKANGKWTSTRMDSDQFDMHVFFGAIADQALIAKYIYSRDLRGDERVAKQLKI
SRTVLDSVTIVPFNDRSLAANLDKYDRFLASLVASTDLLNSAIESESYIEIIVVSANQID
AYLRLSIVIAKQLQAESDDIDVNYLYQAGDKGFLERKIFDHALQLGVVDQTLYDELSALY
SLRNRIVHRYIISSIKTRDMISVVTRYLEMSEKMRLVLNKFEDLEIGKSFGIYGRGFVRA
ELPDETETRRVHSWANDKHQIGKFKRKIVEQKGTDLFVDGNDGARD
Download sequence
Identical sequences C6E4I0
WP_015836729.1.50895 gi|253700047|ref|YP_003021236.1| 443144.GM21_1419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]