SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6HF72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6HF72
Domain Number - Region: 18-91
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6HF72
Sequence length 134
Comment (tr|C6HF72|C6HF72_AJECH) Uncharacterized protein {ECO:0000313|EMBL:EER40949.1} KW=Complete proteome; Reference proteome OX=544712 OS=(Histoplasma capsulatum). GN=HCDG_04595 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MKSFLILLTAVYFIIVPHTLARRRVENINLVHNSEKNSNGLISTSGDKNVNKYLSYQPRS
HDGFEVHKTHDHLLPSERIQQSAQVLNKLKRAAAGCMRYPCDNSIICFSKLCGGCVIASG
SKAGVCSERYHPPR
Download sequence
Identical sequences C6HF72 F0UNS3
HCEG_06050T0 HCDG_04595T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]