SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6WC82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6WC82
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.26e-33
Family Bacterial S-adenosylmethionine decarboxylase 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6WC82
Sequence length 137
Comment (tr|C6WC82|C6WC82_ACTMD) S-adenosylmethionine decarboxylase beta chain {ECO:0000256|HAMAP-Rule:MF_00464} KW=Complete proteome; Reference proteome OX=446462 OS=3971). GN=Amir_5655 OC=Actinosynnema.
Sequence
MSELPCETEPVGLFAGQHVLAELEGVSPELLDDERFLRHALGEALTQADATVLEVVSKQF
DPQGVTVLALLSESHASIHTYPEVGKVFVDVFTCGTRAKPELAVRLLSEALGAEHARTDT
VRRGTGRVPALVGEEKS
Download sequence
Identical sequences C6WC82
WP_015804355.1.52053 446462.Amir_5655 gi|256379656|ref|YP_003103316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]