SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7GY93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GY93
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.54e-27
Family N-acetyl transferase, NAT 0.000000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GY93
Sequence length 159
Comment (tr|C7GY93|C7GY93_YEAS2) Gna1p {ECO:0000313|EMBL:EEU04224.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_05520 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM
QYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIGQLV
TIGFDYGCYKIILDCDEKNVKFYEKCGFNNAGVEMQIRK
Download sequence
Identical sequences A0A0L8VR51 B3LUJ2 C7GY93
YFL017C YFL017C YFL017C YFL017C SCRT_05531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]