SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7GZX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GZX1
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-82
Family Protein kinases, catalytic subunit 0.00000268
Further Details:      
 
Domain Number 2 Region: 474-534
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 406-466
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000955
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  C7GZX1
Domain Number - Region: 338-399
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7GZX1
Sequence length 614
Comment (tr|C7GZX1|C7GZX1_9FIRM) Kinase domain protein {ECO:0000313|EMBL:EEU03261.1} KW=Complete proteome; Reference proteome OX=592031 OS=Eubacterium saphenum ATCC 49989. GN=GCWU000322_00538 OC=Clostridiales Family XIII. Incertae Sedis.
Sequence
MKILAGRYEIHEKIGEGGMAVVYKAKCRLLKRNVAIKMLKPEFTHNRNFIDSFVRESRAA
AKLSHPNIVSIYDVGREGDVYYMVMELVEGKLLSDLIDRGPMKPKAVVDIAIQVVNALAF
AHQNKIIHRDIKPHNILINSEGVAKITDFGIARAMDKSSNEKNTEAVIMGSAHYFSPEQA
NGKNINERSDIYSFGVVMYEMITGRVPFDGKSALDIAIKHIGEEPKPIESVISGVPKPLI
DVINKALQKRQTDRYETADELFEDLLEVQTMLEQGVMHQKREKPMNEGAVRKREEGPLKK
KSKKNNKKKYIIAGIAAVALLAAIIFAVSGGFSSSENKIPDLKGKTIEEAKEAIKNTKYT
LKEGEEVYDNDVEKGKIAKQEPDAGETVKGSQEIVVHLSKGPEDGRVPNVVGKTEEEAKK
IITDAGFKVGDIERKPSSKDKGTVIEQSPKAGKKAEKDEEISIVVSSEKEEKARVPDLKG
MSESQAKEVCASNDLKMAISGYIESDQEKDKVAYQSIKPGEKVKKDTTIYVKLSKGKSES
AKTKNIMVDFSKAPKGKFRLQVEVSDKNGTRTVLDRYARKSEGGTSVKVKATGRAKVVIR
MNGKIVESQYVNFN
Download sequence
Identical sequences C7GZX1
WP_005838223.1.92825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]