SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7M9P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7M9P0
Domain Number 1 Region: 20-210
Classification Level Classification E-value
Superfamily MetI-like 7.46e-37
Family MetI-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7M9P0
Sequence length 219
Comment (tr|C7M9P0|C7M9P0_BRAFD) Amino acid ABC transporter membrane protein {ECO:0000313|EMBL:ACU84584.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_07280 OC=Brachybacterium.
Sequence
MTPNTSWWDWDHAAAVLPKLLLEGFKVTLIATVLGTLIALVLGLMVAIIRRSAPKLLSTP
FTWVVEFIRMTPLVVQLVFANLVLSPYVDSTLVIGIWVLGIHYTTYMAEVYRAGIDSVPT
GQWEAATALSLPRVRTWRAVVVPQAIRNTLPALGNYAISMFKETPFFVVIYIPELVRVAQ
QYGSSYFRYTEAITLAGLIFLAASYPTSLLIRRLEKKLA
Download sequence
Identical sequences A0A1X6XAG1 C7M9P0
446465.Bfae_07280 YP_003154174.1.138 gi|257067919|ref|YP_003154174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]