SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MA09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MA09
Domain Number 1 Region: 39-320
Classification Level Classification E-value
Superfamily MetI-like 2.52e-57
Family MetI-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7MA09
Sequence length 320
Comment (tr|C7MA09|C7MA09_BRAFD) Carbohydrate ABC transporter membrane protein {ECO:0000313|EMBL:ACU86679.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_29180 OC=Brachybacterium.
Sequence
MTTTPSPSPSVAAQTAPAVLPPAGRKRAKPAQRPLTRGEKGFRVINVIILSGFALLCVIP
FVHVIGSSFATPGELATSNFLLVPREFTLDAYRYILSTPTIFRAIGVSTIVTVGGTFLSL
LVTALMAYALAKPRLVGRRVINFMVVFTMLFSGGMIPTFIVVSKLGLLDSLWSLVLPVLI
NAFNFVIMRNFFSGIPESLEESARIDGCSELGVFVRIVLPLSIASIATIGLFYGVTYWNT
YMHAVLYINDSSKWPIQVLLRQIVIVASGVNADAGAVDVVPPAQSVKMAVITVATLPMLM
VYPFIQRYFVKGALIGSVKG
Download sequence
Identical sequences A0A1X6X1P1 C7MA09
gi|257070014|ref|YP_003156269.1| YP_003156269.1.138 446465.Bfae_29180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]