SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MA79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MA79
Domain Number 1 Region: 36-303
Classification Level Classification E-value
Superfamily MetI-like 1.68e-63
Family MetI-like 0.0000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7MA79
Sequence length 304
Comment (tr|C7MA79|C7MA79_BRAFD) Carbohydrate ABC transporter membrane protein {ECO:0000313|EMBL:ACU86749.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_29880 OC=Brachybacterium.
Sequence
MSAPTLPGPGQTAPERPARRRDNGPFSRANLWATLTGGYLPLLVATLVMVLPLLWMVISS
FKSPHEILSTDLVVLPADPSLSNYEQAWNSVPIPRFFLNSVIVTTIGSSIKVLLAVFTAY
ALVFVRFPFKRVIFVLILVALMVPPQVSILPNYVLIAGLGGVNTYWGIILPGLGTAFGTF
LLRQFFLTIPPAMLEAAELDGAGHLRTLFSVVVPISVPTLATVALVTIVTEWNDYIWPLI
ITSEASRMTLPVGLTALNNSEGNTGAGWGILMAGTVLVIAPVLLVFAMLQRHIVSGLTQG
SVTG
Download sequence
Identical sequences C7MA79
gi|257070084|ref|YP_003156339.1| 446465.Bfae_29880 YP_003156339.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]