SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MA94
Domain Number 1 Region: 11-194
Classification Level Classification E-value
Superfamily MetI-like 9.94e-20
Family MetI-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7MA94
Sequence length 216
Comment (tr|C7MA94|C7MA94_BRAFD) ABC-type proline/glycine betaine transport system, permease component {ECO:0000313|EMBL:ACU86764.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_30030 OC=Brachybacterium.
Sequence
MTWVRENLDVIAAYTGAHLLQALPPILVAFALSLPLAKLANSRGWLRTGVTTTSGLMYAI
PSLPLFVLLPGLVGTGVRSPLNIAVALSLYGLALMVPTASDAFRSVSRDVLGSATAQGYA
PAARFLRVELPLAGPVLLAGVRVVAVSTISLVTVGGVLGVPSLGMLFVDGVRRGIVEEIA
AGIVATAALALLTDALLVLLGRAVMPWTRQPEVRRP
Download sequence
Identical sequences A0A1X6XH87 C7MA94
446465.Bfae_30030 YP_003156354.1.138 gi|257070099|ref|YP_003156354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]