SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7MAH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MAH1
Domain Number 1 Region: 23-223
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.36e-41
Family Eukaryotic type heme oxygenase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7MAH1
Sequence length 223
Comment (tr|C7MAH1|C7MAH1_BRAFD) Heme oxygenase {ECO:0000313|EMBL:ACU84729.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_08750 OC=Brachybacterium.
Sequence
MTTTTSPSAQAASQDPAALSAASFSVVLRDATREEHTAAEERGFITQLMGGELSEADYWR
LLAQYLPLYEALEQAIEAAAAEDDLAAAFHDPRFARVAAIRADLAARFGADHEIDAPLPI
TARYAHRIRTASVPQLLAHHYLRYLGDLSGGQAIGALVARHYQVPREQLTMWDFSDIDAP
KRVKDAYRAHLDEITDPAVREEFLAETKLGYELAGELFTALER
Download sequence
Identical sequences C7MAH1
YP_003154319.1.138 gi|257068064|ref|YP_003154319.1| 446465.Bfae_08750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]