SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MBE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7MBE4
Domain Number - Region: 23-68
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.0628
Family MPP-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7MBE4
Sequence length 162
Comment (tr|C7MBE4|C7MBE4_BRAFD) Uncharacterized protein {ECO:0000313|EMBL:ACU84917.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_10690 OC=Brachybacterium.
Sequence
MNRTMPRRHGASALAGTDARALRRRLALLDQDQADLERARELLRQGRLLAAEDPREAFEL
VHRAALRGAGVLVARANRERRRALPLNVWLALERLGGQDAERAESLAPLVAERMRLDRNA
AARPDPELLSTHLAQTSAHLDLVAERLLEDLPTHLTDLAEAG
Download sequence
Identical sequences A0A1X6XKM5 C7MBE4
446465.Bfae_10690 YP_003154507.1.138 gi|257068252|ref|YP_003154507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]