SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MCW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MCW8
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9e-38
Family mannose-1-phosphate guanylyl transferase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7MCW8
Sequence length 251
Comment (tr|C7MCW8|C7MCW8_BRAFD) Glycosyl transferase {ECO:0000313|EMBL:ACU85425.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_15970 OC=Brachybacterium.
Sequence
MHPSNAPLPPTLVVIPTYDEREALPGTLARLRAAVPAADVLVVDDSSPDGTGEWAEAAAA
EDPSVHVLHREGKQGLGPAYLAGFAWGLERGYRQLAEMDADASHRPEQLPRLLEAVRRGA
DLAIGSRWVPRGSVHDWPLRRLLLSRGANLYVRALLGLGVSDATAGFRLFRAELLEQLIA
EDIASQGYCFQIDMTRRSRDLGAAIAEVPIDFDERTEGTSKMSSAIVREALVKVTSWGLS
RRVQGLRKALR
Download sequence
Identical sequences C7MCW8
446465.Bfae_15970 gi|257068760|ref|YP_003155015.1| YP_003155015.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]