SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MDH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MDH6
Domain Number 1 Region: 7-252
Classification Level Classification E-value
Superfamily MetI-like 9.35e-51
Family MetI-like 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7MDH6
Sequence length 256
Comment (tr|C7MDH6|C7MDH6_BRAFD) NifC-like ABC-type porter/molybdate ABC transporter, permease protein {ECO:0000313|EMBL:ACU85633.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_18130 OC=Brachybacterium.
Sequence
MSSLPRWVLVPAVLGGLVILLPLTAMAARVQWTDFVPLITSDASLAALRLSLQTSTVSAA
LCVLLGAPMALVLARCEFPGLSLLRSLVLLPLVLPPVVGGIALLYTFGRQGLLGRQLEVL
GLPIAFSTTAVILAQTFVALPFLVISLEGALRTAGTRYEQAAASLGARPSRVLLRVTLPL
VSPALLSGTVLCFARALGEFGATITFAGSLQGTTRTLPLEIYLQRESDPEAAVALSFLLI
LVAVLVIAVARRRSPA
Download sequence
Identical sequences C7MDH6
446465.Bfae_18130 gi|257068968|ref|YP_003155223.1| YP_003155223.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]