SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MEQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MEQ3
Domain Number 1 Region: 19-307,472-532
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.6e-73
Family FAD-linked reductases, N-terminal domain 0.0000651
Further Details:      
 
Domain Number 2 Region: 309-473
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.71e-41
Family GMC oxidoreductases 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7MEQ3
Sequence length 535
Comment (tr|C7MEQ3|C7MEQ3_BRAFD) Choline oxidase {ECO:0000313|EMBL:ACU86053.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_22540 OC=Brachybacterium.
Sequence
MSSQNPSSQSPVSENPVSEFDYVIVGGGSAGAALAARLSEDPAVQVALLEAGPSDLEHEE
VLQLKRWPELLESGLDWDYPIEPQENGNSFMRHARAKVLGGCSSHNSCIAFHPPAEDMDL
WEELGAEGWNAETVMPLIERLETNRDRSGEGHGTSGPVHLMDVPAEDPLGVALLDACEQA
GIPRARFNDFETVVNGANWFQVNRQDDGTRASSSVSYLHPNFERENLHVLTGMHVMRVLF
DEEQRATGVEYIDNAFDRSSRMHARREVILSAGAIDSPKLLMLSGIGPADHLREVGIDVR
VDSPGVGSNLQDHPEAVISWESTQKMTRESTQWWEIGIFTPTQEGLDLPDLMMHYGSVPF
DMHTRRQGYPTSPESFALTPNVTHARSRGTVRLRSIDYRDKPKVDPRYFTDEEGHDMAVA
VAGIRKAREIVSQPGMDAFRGRELFPGEDVQSDEEIADYVAKTHNTVYHPAGSCRMGAVD
DDMSPLDPQLRVKGVTGLRVVDASVMPQLVAVNPNITTMLIGERAAELIRGEQSA
Download sequence
Identical sequences C7MEQ3
YP_003155643.1.138 446465.Bfae_22540 gi|257069388|ref|YP_003155643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]