SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MF67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MF67
Domain Number 1 Region: 82-308
Classification Level Classification E-value
Superfamily MetI-like 3.14e-54
Family MetI-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7MF67
Sequence length 320
Comment (tr|C7MF67|C7MF67_BRAFD) Carbohydrate ABC transporter membrane protein {ECO:0000313|EMBL:ACU83967.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_00850 OC=Brachybacterium.
Sequence
MTFGRDSGGGAQPGPASTPRRRGGRGHPHRPSAVARSAATPYLFILPALLVYGAFALYPL
GRAAQFSLFEWKGFGSSTFVGLRNYLDLAGDADFRAAIGNALVLIVFYAVIPLVVGLVLA
AILRRGQVRGLGFFRTVIFLPQVIALVVVAVAWRQIYAPSGLLNEALRTLGLGALTRGWL
GDPSTALAAVGFIGTWVQMGLVMLLLLSGMSRIPGELYEAARLDGAGAVREFFAITLPSV
RGEITVSLVLTIIAALKTFDLVYMTTSGGPGNTTTVPSFEVYFRAFELRAVGSASAVAIV
LTALIFVINVGVTRIGERQS
Download sequence
Identical sequences A0A1X6WYH4 C7MF67
gi|257067302|ref|YP_003153557.1| 446465.Bfae_00850 YP_003153557.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]