SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MFB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MFB3
Domain Number 1 Region: 98-313
Classification Level Classification E-value
Superfamily MetI-like 0.0000000000000152
Family MetI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7MFB3
Sequence length 328
Comment (tr|C7MFB3|C7MFB3_BRAFD) ABC-type dipeptide/oligopeptide/nickel transport system, permease component {ECO:0000313|EMBL:ACU84013.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_01320 OC=Brachybacterium.
Sequence
MHLLRKIGFYLVALWAAVTLNFFIPRALPGSPVDAVLAKLALRGPVDPHTREAIEVMLGA
DNDRSLIQEYFAYLGGLFTGDLGVSVTYFPTPVSAVVGQSLPWTLILVGLATTFTFLLGM
VLGTVAGWRRGTWLDSLIPATTILQAVPYFWLALLFIYVLSVNLGVFPISGGYDYTLVRP
AFDYPFLSNAVYYGFLPALTIVLSSLGGWLLGMRNMMVSTLSEDYILTAEAKGLSPRRVM
IMYAARNAMLPSVSGFAISLGFVVSGSIVVETVFSYPGVGFTMLQAVQNNDYPLMQGMFL
IITVSVLAANLVVDLLYGVIDPRTRARG
Download sequence
Identical sequences C7MFB3
YP_003153603.1.138 gi|257067348|ref|YP_003153603.1| 446465.Bfae_01320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]