SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MGV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MGV3
Domain Number 1 Region: 17-186,269-376
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-56
Family FAD-linked reductases, N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7MGV3
Sequence length 510
Comment (tr|C7MGV3|C7MGV3_BRAFD) 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase {ECO:0000313|EMBL:ACU84294.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_04210 OC=Brachybacterium.
Sequence
MPRSAAPDLPATDVLTTDVLVAGAGPTGLMAGLVLARRGVRALVIDPKPGPTRESRAIVV
QPRSMEIFDQLGLADAVLDSAQLTLQLQIRGGQSPVGADFFAQQQGLTPFPGVQIFEQSR
TESLLGTALAADGAPVLHGHRLVSFTAEAGVEALVEGPEGPLRIRSRFLLGADGASSPVR
HQLGLDFAGVTDDATFCVADLHGVEGAPEDAISVRFGRERFALLFPLGPGGHARLIWLHG
ETHPEQETALAGARQDLGIRYEDVAWFSAYRVHHRVASRFRAGPVMLAGDAAHVHSPVGG
QGMNTGLQDAHHLANLLADVLSGRREERELDRYERERRPVALTLIGATDRAFGIIARTGR
GTALLRRRARHVLALLAPRLLATRFGPYAGGLLGQYRIRYHPVDAGEPAPRWARDRAVGR
RLRPTAENRDALRAMDWQLHSYGTDAARPAVPDWIHGPLVFPPDPAGQLRDDRLYLVRPD
GFVAAAFPLHAGAAAVADVDEALAAYAVVR
Download sequence
Identical sequences C7MGV3
YP_003153884.1.138 446465.Bfae_04210 gi|257067629|ref|YP_003153884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]