SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7MHB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7MHB4
Domain Number 1 Region: 14-153,203-232,335-452
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.15e-46
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7MHB4
Sequence length 457
Comment (tr|C7MHB4|C7MHB4_BRAFD) 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase {ECO:0000313|EMBL:ACU84323.1} KW=Complete proteome; Reference proteome OX=446465 OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860). GN=Bfae_04530 OC=Brachybacterium.
Sequence
MSELPGAAAEQGRCEVLIVGGGPTGLFLAALLARRGVDVVVLERRAVPSRHSRAIGLHPP
ALRALRELGLQRAASEAGVRLDRGSALAGDRPLGEVRFGGRRTASPYVLSLPQTRTEELL
TQRLGALAPQALHRGWTVTAVEEHPSGVEVTARRTDAVPATAPEHTDPAGADGSDHPVRS
VPSLDSPDDAGRQRAERRALGEEEGAPGRWRAELVVVADGSRSGTRTRLGIPMRGRGYRD
SYLMGDFADAGRGPRRARIHLERGGVVESFPMPEGRRRWVVHTGCTGTASRRGAVPRPAS
APRLTSLVKERLGAGPDPETATMLSAFTVAQRRAARLCTARCMLVGDAAHEVSPIGGQGM
TLGWLDALEVAPLIVRVLRSRPIMDFATAPEWARVERRILRRARWAGWIAGVNTVLGRPA
PGVLCGVRAAALVVVLRSPARTLLAWLYSMGWTDLQR
Download sequence
Identical sequences C7MHB4
gi|257067658|ref|YP_003153913.1| YP_003153913.1.138 446465.Bfae_04530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]