SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7NDR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7NDR5
Domain Number 1 Region: 203-398
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.52e-67
Family B3/B4 domain of PheRS, PheT 0.000022
Further Details:      
 
Domain Number 2 Region: 36-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.09e-46
Family Myf domain 0.0041
Further Details:      
 
Domain Number 3 Region: 469-691
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.44e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00039
Further Details:      
 
Domain Number 4 Region: 701-797
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-23
Family Anticodon-binding domain of PheRS 0.0017
Further Details:      
 
Domain Number 5 Region: 407-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000211
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7NDR5
Sequence length 798
Comment (tr|C7NDR5|C7NDR5_LEPBD) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=523794 OS=NCTC 10249 / C-1013-b). GN=Lebu_2176 OC=Leptotrichia.
Sequence
MLISLNWLKQYIDLDGIEINEMENALTMIGQEVEKIEVLGENLENVVTAHIVEKEMHPDS
DHLTICKVDNGKEILQVVCGASNHKAGDKVVLAQVGAKLAEDFVIKKGKIRGVESNGMLC
SEEELNIGKDSDGIMILPQDTPAGIPMKEYLGINDTVFELEITPNRPDCLSHIGIARELG
AYYGKEVKYPSFVINTESSEKTADNISVEISDSNLAKRYVARIIKNVTVKESPKWLKERV
ESIGIRSINNIVDASNFVMMELNQPNHAFDLDKIEGGKIVVRAGLENEKLVTLDEHEREL
NSDDIVISDAVKAVALGGVMGGENSQITENTKNILLEVANFNSQNVRKTSRRLTLSSDSS
YRFERRVDEENAINVINRLANLIQEVAGGEILAGAVDNYPVPYEKKSAELNFERLNRFVG
KAIPRETVVGILTRLEIEVIDNGETLTLTAPSYRDDLENEQDYFEEIIRMYGFDNIENIL
PKLDISEQPVIDTTKLSTQVKLIAANAGLKEVINYSFVPKDAMEKIKYTVAQEKLIDVLK
PITEDFVTLRPTLLYSLIKNAKDNINRNVSNIRFFEVSRTFEKAEELAKEEVKLGIILAG
ENDKTLWNPKPVPYDFYDLKGIVEEIFTQLKFNNYMIKRSEQSQFHPGRSVDVFVGRELI
GSFGEIHPDVLENFDLGKTSVLVGEFNIDLIQKYIGKKANYQGIVKYPAVPRDFAFVMKE
EILVGDVLKTIQKVDKKIEKVELFDIYQGVGVLPGMKSVAISVVLRDKSKTLEEKEIVDI
SNKIVAKVEKDYGAVLRQ
Download sequence
Identical sequences C7NDR5
gi|257126906|ref|YP_003165020.1| WP_015770364.1.20655 523794.Lebu_2176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]