SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7NFT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7NFT2
Domain Number 1 Region: 122-280
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 6.8e-41
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 6.12e-23
Family DHN aldolase/epimerase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7NFT2
Sequence length 295
Comment (tr|C7NFT2|C7NFT2_KYTSD) 7,8-dihydroneopterin aldolase {ECO:0000256|RuleBase:RU362079} KW=Complete proteome; Reference proteome OX=478801 OS=(Micrococcus sedentarius). GN=Ksed_24750 OC=Bacteria; Actinobacteria; Micrococcales; Dermacoccaceae; Kytococcus.
Sequence
MIRLAGVRAHGHHGVFEHERRDGQEFVVDLVAHLPVGAGGGDEISATLHYGEAAEALVEV
LAGEPVDLLETLVERLLDAVEQLPGGRACPRLEVTVHKPQAPITVPFADVSVTGVRDQRV
PAVVALGANLGDATGTLASAVGELAELPGVELVGLSPLVESDPVGGVEQPVYLNAVARVE
TTLAAADLLAALHRIEARHGRTREVRWGARTLDLDLIQHGDPRAGTEVRCVPEGVGLHLP
HPRASERAFVLGPWLAVDPVAELDGRPVSQWLAELDQDGVRSGPPWPALTRGGRA
Download sequence
Identical sequences C7NFT2
478801.Ksed_24750 gi|256826245|ref|YP_003150205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]