SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7NVA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7NVA4
Domain Number 1 Region: 155-335
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.09e-21
Family TAP-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7NVA4
Sequence length 338
Comment (tr|C7NVA4|C7NVA4_HALUD) Uncharacterized protein {ECO:0000313|EMBL:ACV11188.1} KW=Complete proteome OX=519442 OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2). GN=Huta_1005 OC=Halorhabdus.
Sequence
MQLEAFPSVSLHNVAELAPADWTNGGGHLHRVPRDVAANLNVMARDRVQSPTGSEIRFVP
DGDDATVEVTLSAAGETTVQPFWGPFQGAEPFEIGPDPSTHTFSVPDRVRNLDPAAAEDA
AYDTRICRLRFDAWSRVALHDVAGDARPPRDAELPDTRYLAYGTSITEGALSNPHLAYVA
TAARQLGVDPINLGMAGSAYCEPAIADHIAGRDDWDFATIAVSVNMSNRGFTVEQFRESA
DQLLDTVAGAHPEKPIVAVSLFPYHADVVAGDDPERAAAYRETLETLVTESAHDNLSFID
GSKLLSVPGLMDDILHPGDAGMVEIGHNLAEELEPLVE
Download sequence
Identical sequences C7NVA4
519442.Huta_1005 WP_015788765.1.40337 gi|257052088|ref|YP_003129921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]