SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7Q1X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7Q1X8
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily YaeB-like 4.84e-44
Family YaeB-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7Q1X8
Sequence length 151
Comment (tr|C7Q1X8|C7Q1X8_CATAD) Uncharacterized protein {ECO:0000313|EMBL:ACU75679.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_6838 OC=Catenulispora.
Sequence
MTNIIPIGQVVGGRAEPRDDDWGGEQAVIRLDDRFGPEALAGLDAFSHLEVVYQFHLVDP
EKVQTGARHPRNNTEWPLVGIFAQRGKNRPNRIGVSRCRLVKVEGRDVHVTGLDAVDGTP
VLDLKPYMAEFGPIGEVAQPEWATELMREYY
Download sequence
Identical sequences C7Q1X8
WP_015795407.1.73754 gi|256395956|ref|YP_003117520.1| 479433.Caci_6838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]