SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7R0K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7R0K9
Domain Number 1 Region: 1-295
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.22e-85
Family Phase 1 flagellin 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7R0K9
Sequence length 295
Comment (tr|C7R0K9|C7R0K9_JONDD) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=471856 OS=(Listeria denitrificans). GN=Jden_2035 OC=Bacteria; Actinobacteria; Micrococcales; Jonesiaceae; Jonesia.
Sequence
MGLSINQNIAAVNSYRNLANTQNDLSKSLEKLSSGFRINRAADDAAGLAISEGLRSQVGG
LKVAARNAQDGISVVQTAEGALTETHAILQRLRDLAVQGANDSNNTEARDNIKTEADSLI
KELGRIGESTNFNGTKLLSGDVDSGTTGAQTTLNFQVGADGDANSRITVNLANANVVGVA
TALGYDTATGNVNATAFDVTDHASSQATITAVNAQIESVSTARAELGAYQNRFEHTIKNI
NVAVENLSASESRIRDTDMAQEMVQFTRAQILSQAGTAMLAQANQIPQGVLSLLR
Download sequence
Identical sequences C7R0K9
gi|256833249|ref|YP_003161976.1| 471856.Jden_2035 WP_015772301.1.34072 WP_015772301.1.39474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]