SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7RA28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7RA28
Domain Number 1 Region: 147-341
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.19e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000085
Further Details:      
 
Domain Number 2 Region: 427-556
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.05e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000164
Further Details:      
 
Domain Number 3 Region: 13-146
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.27e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 
Domain Number 4 Region: 343-417
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7RA28
Sequence length 568
Comment (tr|C7RA28|C7RA28_KANKD) Sulfite reductase [NADPH] hemoprotein beta-component {ECO:0000256|HAMAP-Rule:MF_01540, ECO:0000256|SAAS:SAAS00884208} KW=Complete proteome; Reference proteome OX=523791 OS=Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125). GN=Kkor_0727 OC=Kangiellaceae; Kangiella.
Sequence
MSKVKPTIYDPKKHTVVETIKVNSNYLRGTLEQSLKSELTGAIADDDQMIIKFHGSYQQD
DRDLRAERRKQKLEPLYSFMIRARLPGGIASVEQYKVLAKVAQDYGHSSLRLTTRQTYQW
HGVVKRHLKQTIAGINTALVDSIAACGDVNRNVMANPLFEQSKLHAEVYEWSKKISEHLL
PNTNAYHEIWLDGEKVESTEEPIYGKTYLPRKFKIAIAVPPNNDVDIYANDIGLIAITEN
ETLIGFNVLVGGGMGSSHNDPETYPRAASVIGFCKPEETLKVVESILKVQRDYGNREVRK
LARLKYTIDRLTVEGFKETLSDYVGWSLQPAQPFSFEHNGDRYGWIKSDDGKWHLTLYIH
SGRIKDTEQSQVFTGLLKITDVHDGEFRCSPNQNLIISNVREENKAAVEQILEQHNISIG
QTETPTRLHALACVAFPTCALAMAEAERYLPTLLDKIEVQLERYGIANVPINIRMTGCPN
GCARPYLGEIGFVGKAPGKYNLYLGASHTGDRVNKLYRENINEAEILKELDPIFASFAQH
RSPEESFGDFVIRQGYVAAVHNGDDFHA
Download sequence
Identical sequences C7RA28
WP_012800661.1.96353 gi|256821952|ref|YP_003145915.1| 523791.Kkor_0727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]