SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7RFW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7RFW6
Domain Number - Region: 142-205
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000536
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7RFW6
Sequence length 206
Comment (tr|C7RFW6|C7RFW6_ANAPD) Uncharacterized protein {ECO:0000313|EMBL:ACV28377.1} KW=Complete proteome OX=525919 OS=(Peptostreptococcus prevotii) (Peptococcus prevotii). GN=Apre_0326 OC=Anaerococcus.
Sequence
MMFELVIGLSFVLAVVSLISVLFTEKKAFFAISALAFLGVFYFTNSTHPIAEVWPLISFV
AGVTLLALEIFIPSFGLIGICGLVLVGLSLYNSFMMDGREVILLVAATLAIILSVTVYVT
LGFRANIFDKEILKSVNSRERGYNSKVDYSHLLAKRGRTKSILRPTGRIEIDGKYYDATS
QGDFIKPLAKIEVVSVKDGHIVVKEI
Download sequence
Identical sequences C7RFW6
gi|257065842|ref|YP_003152098.1| 525919.Apre_0326 WP_015777290.1.19141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]