SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8VEX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8VEX3
Domain Number 1 Region: 105-148
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000105
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000886
Family Retrovirus zinc finger-like domains 0.0009
Further Details:      
 
Domain Number 3 Region: 69-128
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000121
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 4 Region: 3-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000767
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 5 Region: 150-170
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000293
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C8VEX3
Sequence length 171
Comment (tr|C8VEX3|C8VEX3_EMENI) Zinc knuckle domain protein (Byr3), putative (AFU_orthologue AFUA_1G07630) {ECO:0000313|EMBL:CBF80881.1} KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=ANIA_05111 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSFGGRVCFNCGEATHQARDCPKKGTPTCYNCGGQGHVSRECTVAPKEKSCYRCGAVGHI
SRECPQAGENERPAGGQECYKCGRVGHIARNCSQGGSYGGGFGGGYGGRQQTCYSCGGFG
HMARDCTQGQKCYNCGETGHVSRDCPTEAKGERVCYQCKQPGHIQSACPNN
Download sequence
Identical sequences C8VEX3
162425.CADANIAP00003095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]