SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C8VZC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8VZC2
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.67e-71
Family Phosphate binding protein-like 0.000000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8VZC2
Sequence length 282
Comment (tr|C8VZC2|C8VZC2_DESAS) Menaquinone biosynthetic enzyme MqnD {ECO:0000256|HAMAP-Rule:MF_00996} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_4199 OC=Desulfotomaculum.
Sequence
MKIVFSPCPNDTFIFHAWVHGLVPGAPELDVALADIDVTNKLAAGPNGPDIIKISFAALP
WVLSKYALLPCGGALGRGCGPLVLVANKPCGIINPADLAGRRVAVPAERSTAYLLFRLWL
DQHVPGGVGEIIILPFHEIMPAVRDGLVDAGLVIHESRFTYPSFGLTLLVDLGSWWESDT
NLPIPLGAIVARRTLDLSAITGWLRESVKYAWAHPEASQEYVLRHAQELSPEVAKAHIRL
YVNEFTLNLGEGYGAVISLLSRAAQAGLIPDVNLSKLSLTEL
Download sequence
Identical sequences C8VZC2
485916.Dtox_4199 gi|258517268|ref|YP_003193490.1| WP_015759537.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]