SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C8W2P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8W2P6
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily AF1862-like 1.05e-38
Family Cas Cmr5-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8W2P6
Sequence length 133
Comment (tr|C8W2P6|C8W2P6_DESAS) CRISPR-associated protein, Cmr5 family {ECO:0000313|EMBL:ACV63730.1} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_2976 OC=Desulfotomaculum.
Sequence
MSKTLEQERAADALQKVKEVRQERKDLLIEYSSYAKSLPATILANGLGQAAATLLAKAKD
NKKDAHYILYTHLREWLCSDREVVPYNKGEDLMEAITSNDRNAYIRAQAEALAWLQWLKK
FAAAYLHNPEGEK
Download sequence
Identical sequences C8W2P6
WP_015758422.1.30109 485916.Dtox_2976 gi|258516131|ref|YP_003192353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]