SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C8W5T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8W5T0
Domain Number 1 Region: 50-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000000264
Family Phosphate binding protein-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8W5T0
Sequence length 364
Comment (tr|C8W5T0|C8W5T0_DESAS) ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components-like protein {ECO:0000313|EMBL:ACV64080.1} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_3350 OC=Desulfotomaculum.
Sequence
MRLHKRTLVIIAAFAIFIITPALYFYFNKLHKTAAADTLPVIEDCRSLSGLPQYIAMKKG
YFEEQNLKIELKTASTSQELHEAVKTKKRSIVLCGSETIVNYLSQDSCNMMVFAGLTDRE
DSFLLGRPDVSEFTKEKVRGNSIIVSSPDSLQSMVLENILREKKIWPNYEVNLMQNLPDN
LKRGAFKSGTATFIVLTEPEATLLETAREAKTLLAFAAAGGELPAVVLACDKQLLLSKPQ
TVQKYTNAVYKAILWINCHNTGDIVALIKEFYPNTDQKLLISAVNRYKDLSIWTETPVIT
QKSYENLLNIMENSGELTRPKKYNDVIDNRFATEAVQSITYTPEEEQKKGFFNTIFKHFN
FWQR
Download sequence
Identical sequences C8W5T0
WP_015758770.1.30109 485916.Dtox_3350 gi|258516481|ref|YP_003192703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]