SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C8WQT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8WQT3
Domain Number 1 Region: 21-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.05e-56
Family PP-loop ATPase 0.0000429
Further Details:      
 
Domain Number 2 Region: 399-459
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000183
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 217-324
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000392
Family MesJ substrate recognition domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8WQT3
Sequence length 475
Comment (tr|C8WQT3|C8WQT3_ALIAD) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=521098 OS=104-1A) (Bacillus acidocaldarius). GN=Aaci_0198 OC=Alicyclobacillus.
Sequence
MGRAHNLLTHVISFFQQHRLETAHAVLGVSGGVDSMVLLHLCQRAAEEAPSALGGFSVVH
VHHHLRETADRDAAFVERYCREREIPCEIAHVKVVDERGEGLEAAARRARYQALADRARV
KGGVILVAHHAQDELETFIMRLLRGAGPGGLGAMRPEAEMNGVRVLRPLLAVEKSEIERY
AALHGVPHVEDETNEDPRFFRNRVRQVVIPALRAVEPRAEEKVRQALELLWAEDAYMREL
ACEAARRVAVCGADGRIAFSASRLGELHVSLQRRVIHILLNCFSAREWTLAHVEAVRRLA
LSGPPSGEVHLAADVRCVRSYDNLYIGHPPIARPAVETAVAWDLHSAAEVLVGEGEVRWR
FRRLRVAHPASARMPSPWWLLLPADVSRAEIAMGVPTSERVPLFGGHGTKKLQDVFTDAK
LPRAWRARWPLLRVDGDIVWIPGIMRSGAHLWGGGPAFVIRARPPAACQRALGER
Download sequence
Identical sequences C8WQT3
WP_012809639.1.29831 521098.Aaci_0198 gi|258510216|ref|YP_003183650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]