SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9E895 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9E895
Domain Number 1 Region: 110-592
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.29e-132
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9E895
Sequence length 593
Comment (tr|C9E895|C9E895_RAT) Glutamic acid decarboxylase 67 variant GAD67C {ECO:0000313|EMBL:ACV92036.1} OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_26162 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKS
RLVSAFRERQASKNLLSCENSDPGARFRRTETDFSNLFAQDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSN
KDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences C9E895 P18088
ENSRNOP00000000007 10116.ENSRNOP00000000008 NP_058703.1.100692 NP_058703.1.4139 XP_017446943.1.100692 XP_017446944.1.100692 ENSRNOP00000000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]