SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9IZC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9IZC9
Domain Number 1 Region: 91-169
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.39e-21
Family GABA-aminotransferase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9IZC9
Sequence length 177
Comment (tr|C9IZC9|C9IZC9_HUMAN) 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial {ECO:0000313|Ensembl:ENSP00000406719} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GCAT OC=Catarrhini; Hominidae; Homo.
Sequence
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGPGTVIFPGLPLPHLSCCIHLLSFTSGILNFCANNYLGLSSHPEVIQAGLQALEE
FGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFESRALVQPG
Download sequence
Identical sequences C9IZC9
ENSP00000406719 ENSP00000406719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]